PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_5BL_DE53199D3.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family bZIP
Protein Properties Length: 365aa    MW: 39091.1 Da    PI: 8.9812
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_5BL_DE53199D3.3genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_142.51.5e-13286336555
                            CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                 bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55 
                            +r+rr++kNRe+A rsR+RK+a++ eLe +v++L+  N++L  + +e+ ++
  Traes_5BL_DE53199D3.3 286 RRQRRMIKNRESAARSRARKQAYTMELEAEVQKLKDLNEELVRKQKEILEM 336
                            79************************************9887666655444 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.6E-10282340IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.576284333IPR004827Basic-leucine zipper domain
SuperFamilySSF579595.7E-10286333No hitNo description
CDDcd147077.77E-25286338No hitNo description
Gene3DG3DSA:1.20.5.1703.3E-13286333No hitNo description
PfamPF001701.3E-11286336IPR004827Basic-leucine zipper domain
PROSITE patternPS000360289304IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 365 aa     Download sequence    Send to blast
MLKEDRWGGT EGIMDFRSSN GGSSSERGPA EAAPLTRQGS IYSLTFEEFQ STLGGGAGVG  60
GSDLGKDFSS MNMDELLRSI WTAEESQAMA ASASGAGAGP PPTSLQGQGS LTLPRTLSAK  120
TVDEVWRNLV RDDPLPVGAE GAXQPHRQAT LGEMTLEEFL VKAGVVREIP TAPAVPAPPM  180
QPRPVPVVPK GPSFYGNFPS ANDAGAAALG FPPVAMGDLA LANGLMPRAV GMGGAPLVVQ  240
TAVNPVDSGG KGSEDLSSPS EPMPYSFEGI VRGRRTGGGV EKVVERRQRR MIKNRESAAR  300
SRARKQAYTM ELEAEVQKLK DLNEELVRKQ KEILEMQKRE QAPEMKDQFG RKKRQCLRRT  360
LTGPW
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB3628190.0AB362819.1 Triticum aestivum Wabi5-2 mRNA for basic region leucine zipper protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003578228.10.0PREDICTED: bZIP transcription factor TRAB1-like
SwissprotQ6ZDF32e-95TRAB1_ORYSJ; bZIP transcription factor TRAB1
TrEMBLW5FJ420.0W5FJ42_WHEAT; Uncharacterized protein
STRINGMLOC_66546.20.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP70638147
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G49720.11e-53abscisic acid responsive element-binding factor 1
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]